DPCstruct | MC4000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 112 ± 10 aa |
| Standard deviation of domain lengths | 10.40 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13811 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R0TCP1 | 12-120 | EQQWIATMLERLSHSQFRAKFALTDKDRAYARTKGKATIDRHAREMLRDRIGAAEPKNDGRQTPWRGHPVFTAQHATATCCRGCIEK… |
| A0A3D4XD77 | 109-222 | PDYQTVKTVMRTSMWNDEWLHTALDRVAQAGLTKINRQKVKNRLLKSIGTCPADDGRQTPYYGNAIYYAQHGLGYCCRKCLEKFYGI… |
| A0A1Y4U7H0 | 91-207 | None |
| A0A7H1NQR7 | 12-126 | None |
| R5ZYZ0 | 84-198 | None |
| A0A447QFA2 | 6-93 | None |
| A0A227KSC3 | 5-117 | None |
| A0A1I2SU89 | 197-308 | None |
| A0A7J2R2Z1 | 70-198 | None |
| A0A495QX44 | 103-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.