DPCstruct | MC400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 10.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0706 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0CM13 | 538-630 | AIRNNASAVEYCRTSMAALSGSTAGILGLTGIIGFLFYLFAVFGLWFLLLSKSGTNWQKYFISRRSLLTNGFMGGLCTYVLFWTFLY… |
| A0A1X7RSB2 | 14-106 | QDSVQHNMRTVSNIRALTASLFGVAAGTIGLESLPGFIFYFIGTGIVSLLIFSLKAEKKAEAYFWSPGSDLWMGDLFGGLMSFVLTW… |
| C0HF60 | 4-111 | None |
| A0A0V0QE27 | 18-138 | None |
| A0A1V8SMW8 | 232-341 | None |
| I1HQG0 | 35-145 | None |
| A0A2G3B566 | 10-118 | None |
| A0A314YUC6 | 150-249 | None |
| A0A7J7J6M8 | 27-121 | None |
| A0A7R9QRI7 | 200-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.