DPCstruct | MC40
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 236 ± 18 aa |
| Standard deviation of domain lengths | 17.73 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U8U6D1 | 3-213 | AKEFIRIPQLRTEYQTAIRQMSNEILTIVDKEQDKAKKYMLAKQYSKESYLLRNQILNDIRNKSSEFAKALAKSEKPVLPSFESLIV… |
| A0A7Y8EL74 | 1-244 | MDAPYRNYLARENHSVDAEVLERALESFEGVAVKFSSDFIEDARQRDNYNRNVKRVKAEVLKQVANGSISAKEGAEFCYEMRNKIMA… |
| W6KGH7 | 195-411 | None |
| W6KBE2 | 257-471 | None |
| A0A765T1F9 | 1-239 | None |
| A0A1Q4XFG1 | 75-337 | None |
| A0A1H8QVU4 | 2-234 | None |
| B2VEE3 | 63-302 | None |
| A0A323UP53 | 15-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.