DPCstruct | MC4
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 135 ± 13 aa |
| Standard deviation of domain lengths | 13.06 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372JJE4 | 24-156 | CSVQIRVGKLLLTSLNVTQTYGGLIEGGPSKRFNDRLVQRALESASRGEMPVHLVPPVIKLDERRPHDPTEVLPPLRCIGFFHGPPT… |
| A0A849WD35 | 3-135 | FIELKCGRSVYISDFDYTRTYGGLIEGMPNEKLNNKIIECAMIRMQLIWGKRKTHLIPPKIDTSDPKHPSLPSTQLTAYIVCNDPVN… |
| A0A8A9EYB4 | 2-162 | None |
| A0A5C6B888 | 12-158 | None |
| A0A2Z3HGU4 | 76-212 | None |
| A0A496WSG5 | 1-139 | None |
| A0A8B4ZHI9 | 6-116 | None |
| A0A2U1JKC2 | 5-126 | None |
| A0A1Q3HMK2 | 2-129 | None |
| A0A553BDD9 | 7-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.