DPCstruct | MC39998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 58 ± 6 aa |
| Standard deviation of domain lengths | 5.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 49.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R6JF36 | 1-64 | MTEPRECRRCHKPVVASAADYGVFERMHYVCFHFEFEHQGDPDVECLAGGCPAAGISLPSRHSH |
| A0A7V8CZA6 | 1-55 | MTTPEPLICVRCHQPVTAKADQYELFEHMHWLCFHLEFEHQADPDVPCDDPSCPW |
| A0A1H9MP87 | 13-82 | None |
| A0A1I3ABI9 | 110-170 | None |
| A0A4R2HST5 | 3-58 | None |
| A0A6L5G1M0 | 98-152 | None |
| A0A3D1TD05 | 11-61 | None |
| A0A2S6ITJ1 | 2-62 | None |
| A0A4Y3KLI1 | 34-92 | None |
| A0A212LU13 | 2-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.