DPCstruct | MC39992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 249 ± 36 aa |
| Standard deviation of domain lengths | 36.37 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6TQP6 | 11-210 | SLQGHTIQSMEEAIQILNECSRDDVYPLAMQMQSELSGFVETSEDYLCMLHDFVYKGEYWRGHELDEESFRYSWQAAREAIANRAKR… |
| A0A1B7Y394 | 19-290 | KLRQRRASAEQPLETLLDSTTVSDDALLLDACQAKEIDRFRNEIRLCQDEATRYRLCLQTRDDLLSQHSSLQFLIAAFDQVMLAECA… |
| A0A384J7I7 | 68-322 | None |
| A0A0B4GN51 | 2-250 | None |
| A0A166MTA6 | 22-290 | None |
| J3NZW4 | 2-293 | None |
| J3PGB0 | 3-281 | None |
| A0A6A5VA79 | 1-324 | None |
| A0A5N6XML7 | 2-180 | None |
| G2R871 | 1-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.