DPCstruct | MC39990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 109 ± 7 aa |
| Standard deviation of domain lengths | 6.72 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0LVD0 | 154-263 | QAEVPPETLAQDRVSFSAMLTSPADIELQIGGETTSNFEWISTPPGGVGIYHGSVPFWGRTGTVSIRLLRNDKVFTRLDGPAISSTC… |
| A0A830IB56 | 133-244 | QLELPPTDVAQDRIFFTALLSSPAIVTVSIAGVPESLTWEYTPDGGIGLYHGSMPIGTRTGQVIVTLSRGGKAIAEVIGAPISNTCQ… |
| A0A135SN25 | 332-440 | None |
| A0A7G5KC39 | 172-284 | None |
| A0A164ZUG0 | 346-448 | None |
| A0A1G4BNG9 | 343-439 | None |
| A0A2S6BXM9 | 348-449 | None |
| A0A4T0DJZ6 | 25-146 | None |
| A7EK23 | 138-248 | None |
| T0KH58 | 58-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.