DPCstruct | MC39987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 128 ± 8 aa |
| Standard deviation of domain lengths | 7.83 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123- CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U1ETE6 | 26-154 | TVKEHILTLLDGNKGGYISGEEIAGRLSVTRSAVWKAIKSLQMDGYSIQAVTNKGYSLSPHTDILSAGSISKYLDTQGQKLRVEVFK… |
| A0A7H4NT52 | 7-128 | PLTLISILADAEFHSGEQLGERLGMSRAAINKHIQTLRDWGVDVFTVPGKGYSLPEPIQLLDEEQIARQIEHGRVTVLPVIDSTNQY… |
| A0A6I7Q343 | 1-132 | None |
| A0A5C0XSF8 | 4-115 | None |
| A0A1V2MAD1 | 1-130 | None |
| A0A447TQD2 | 41-153 | None |
| A0A847ZMZ0 | 4-130 | None |
| A0A380FFW8 | 2-122 | None |
| A0A378W183 | 4-136 | None |
| A0A3P7F2V0 | 93-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.