DPCstruct | MC39986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 126 ± 9 aa |
| Standard deviation of domain lengths | 9.37 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1V270 | 1-129 | MLLHGRVVFARDALKELGIPAYEELDGQVVLKTDDGELLPIVPDWRGRAFFQDPRLRNRPVDLVVRRYQRIPYIQVLMIFVREGNKR… |
| A0A3M1MNP5 | 119-251 | SPSTTTYHTERVEGRVVWAADALHEHFGISTVPEARERVLAIWTDDGDLIPLVENLRGRAFRSDERLRQMDLQLVIRRYEKHPFAQV… |
| A0A7X4A9N3 | 13-146 | None |
| A0A257VIW4 | 23-128 | None |
| A0A3L7V906 | 26-154 | None |
| A0A7V5YTN5 | 1-112 | None |
| A0A2E6ALB3 | 49-176 | None |
| A0A836QIH4 | 2-120 | None |
| A0A3E0N314 | 207-339 | None |
| A0A2V8T8T3 | 99-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.