DPCstruct | MC39983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 99 ± 13 aa |
| Standard deviation of domain lengths | 13.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 22.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1T2W8 | 16-119 | RRGDFYWPAGMKQPPLRDRSRTGPRDAELIPPEELEGALALVVRKEYRIARDELIRRAARLLGFGRTGAKLRQVFAEALEALRARGE… |
| A0A0G3HDC7 | 85-189 | VLVGEGSRSFVWPEEASPSTWRRYRKSNGARTIGEIPTTELANAIVAAVADAPEGLDHIAAYRAAMALFGLTRLTESASSYLEEALT… |
| A0A7C3XIU1 | 9-102 | None |
| A0A352Z272 | 25-110 | None |
| A0A086ZQ92 | 37-127 | None |
| A0A512PCL4 | 608-702 | None |
| A0A494RPT3 | 135-239 | None |
| A0A662GNE2 | 934-1034 | None |
| A0A7L7M6A8 | 371-492 | None |
| A0A2S8BGL9 | 200-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.