DPCstruct | MC39981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 123 ± 11 aa |
| Standard deviation of domain lengths | 11.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497BLQ3 | 43-161 | LTGAEHNFTFRPDIRQISGGGVVLHGEDGSRVEIAVRPLSVCYIKAGGYFGYRGFTHGLWMGPYFIDGFKLDLTDPGVIREVSFLDD… |
| A0A655JEC0 | 1-126 | MRIHYRSGTRIPTGATIEASTPDGAPVHFDVESKLAVPTHVGGGYGGDSDWSHGMWKGEKFVERRTYDMTDPTIIARAGFGVIDHVG… |
| A0A6J6XWX3 | 2-107 | None |
| A0A7C7U5P8 | 1-143 | None |
| A0A7V9NVM5 | 133-258 | None |
| A0A2E6CD83 | 106-225 | None |
| A0A7K3BCA9 | 89-206 | None |
| A0A1D2ULZ9 | 1-106 | None |
| A0A7J5X5N4 | 631-761 | None |
| W4A7C5 | 145-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.