DPCstruct | MC39973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 65 ± 3 aa |
| Standard deviation of domain lengths | 2.86 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 95.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R8XNG2 | 224-288 | VGRVDLKNDRQAGVLRVQAAWSEPGAPRDTAERLAGVLRETAAWQGLGAIDVRPRGTLAAALAAE |
| A0A6I5VGK2 | 367-431 | VARVDLKADRERSTLLVPTVNAEPGTDTKIVAAELKAELRQLAGWLGLERIVVGRAGNLAAALRA |
| A0A7V9ILR5 | 179-245 | None |
| A0A2P8AWA3 | 336-396 | None |
| A0A523DNN0 | 337-397 | None |
| A0A2S8BJ81 | 175-241 | None |
| A0A094Q1V6 | 485-554 | None |
| A8KZV1 | 304-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.