DPCstruct | MC39971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Standard deviation of domain lengths | 5.46 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A656H8F2 | 1-85 | NRDFFGSNDYKTVTALGAQISTLLEEGAYVQRGERKKPVTEFKEALAWLMAESTKRHTIQRYKGLGEMNPDQLWETTMDPSVRRM |
| A0A291EPI3 | 15-110 | IDADFVAGADYAALAQTAQTFQGLIGEGAKVRRGTGDKLREQPVSDFHAAMTWLLSEAERGVSRQRYKGLGEMNPEQLWETTMDVTQ… |
| A0A418H122 | 513-598 | None |
| A0A2G2PBU4 | 109-194 | None |
| A0A2X2BN99 | 1-98 | None |
| A0A7V8DBE7 | 24-113 | None |
| A0A0C1JJN0 | 84-176 | None |
| A0A1H3P5J0 | 44-139 | None |
| A0A1J5JJ92 | 157-237 | None |
| A0A6D0EKJ4 | 151-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.