DPCstruct | MC3997
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 240 ± 36 aa |
| Standard deviation of domain lengths | 36.35 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397BRJ4 | 1-195 | MAGQLQWRQVETHATAIRAEKTQDTSSVSYLTGEELIRQICVRMRVRSFDDLNVGPPHAFAPIRQVLDLEHDLWEFVGMYVSLRSIS… |
| A0A2H1CRY1 | 4-248 | PEPIPSSFDLQSIPVRQSQFSSIHEVDNLILQILHDVSQEGRYTGPGCIQEELFRRFPAVFTFLRDIGRNPDTIPRLVEHRRHVQRV… |
| A0A835Q2T8 | 2-294 | None |
| A0A067CTQ9 | 9-248 | None |
| A0A816W939 | 172-390 | None |
| V5BT55 | 4-251 | None |
| D7KI10 | 2-271 | None |
| A0A820VAU4 | 1-232 | None |
| A0A820VE32 | 14-238 | None |
| A0A821SR82 | 1-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.