DPCstruct | MC39969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 54 ± 4 aa |
| Standard deviation of domain lengths | 3.95 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 61.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0378 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3VUS7 | 38-96 | IIHRAVSNRLPWQVGLLGLGEADAVLYKAPLGFDISINEIFLPLVAGARLVVAEPGGER |
| A0A656H7I7 | 1-59 | NSHRALVNRLHWMQKAYALDGSDAVLQKTPFSFDVSVWEFFWPLMTGARLAVALPGDHR |
| A7BXM0 | 67-118 | None |
| A0A2W6C5N0 | 376-427 | None |
| A0A1Q9TE80 | 65-112 | None |
| A0A656H7X7 | 1-51 | None |
| A0A2X3E7C3 | 2-60 | None |
| A0A6A1TFL7 | 82-131 | None |
| A0A540WG62 | 28-84 | None |
| A0A4U9DFI6 | 73-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.