DPCstruct | MC39968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 49 ± 4 aa |
| Standard deviation of domain lengths | 3.56 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 69.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A656H754 | 7-52 | IAAQEGILLTSGGGYIRIKDGNIEIHAPGTIDVKGAKKTFSGPTSL |
| A0A808K1K1 | 65-115 | QTIEGVAKQEILLTSGGAYIRLKDGNIEIHSPGAIDVKGAQHGFNGPVRLD |
| A0A3T0K779 | 1-46 | None |
| A0A2R2IXK1 | 16-66 | None |
| A0A6P2PXB8 | 144-194 | None |
| A0A656H831 | 1-42 | None |
| A0A5B8RHV5 | 193-245 | None |
| A0A7Y9WBN4 | 288-338 | None |
| A0A7G6V290 | 158-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.