DPCstruct | MC39966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 97 ± 4 aa |
| Standard deviation of domain lengths | 4.25 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A656H5T2 | 1-90 | IEAFQLGAAAGNEVAASFLGKGFRGPKPDDRLYYLDQKEDLERAERYKQIWSLLADWSYANPSVPEINEIVPLPPAKLPAWDGKLKW… |
| A0A1C6N3X4 | 216-309 | KNYSEALKYYQLAVKAGDETAAFKLGKVFLAPPPSDGLDYLALEKDEERSRRYKILSDILGRYSYLKPTVNDIDDIVPLPPAKLPPW… |
| A0A0P9H8V4 | 28-121 | None |
| A0A378WRE5 | 64-164 | None |
| A0A1E9VUX5 | 147-243 | None |
| A2W084 | 356-449 | None |
| A0A4S2DSD0 | 1-101 | None |
| A0A0P9RUD8 | 76-171 | None |
| A0A7Y1A8X1 | 181-272 | None |
| A0A369YJW3 | 261-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.