DPCstruct | MC3996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Standard deviation of domain lengths | 7.21 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 39.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U3I8Y6 | 39-120 | CPLTEEMLQEGLSLLCKTGNGLAHAYVKFEAKYKDLTDISLLECFIHLRYVDLSENKLQDLSPLSSLTHLLWLKVDGNLLTS |
| A0A397BG08 | 1-86 | MTQLERSVVRENLSLLGKHPITNKHIFTRLDVKTHNLTAVDVLKDFPYLQDVDVANNQIESLAALAHLPFLISLNAENNHLTTLLG |
| A0A7S0HN54 | 67-158 | None |
| A0A498MUR7 | 34-130 | None |
| A0A1V9Z3Y3 | 178-259 | None |
| A0A3R6ZYC3 | 1-85 | None |
| F0YDP4 | 2-83 | None |
| A0A3M0K532 | 17-117 | None |
| A0A4W3GVV3 | 1-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.