DPCstruct | MC39958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 205 ± 15 aa |
| Standard deviation of domain lengths | 14.77 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0RYP9 | 1-223 | MLDENLPVYFLKPAADGIKHHRDIYLSHHGSSPAPSYALHNTDPASTSPAQKNCYAVALFDAYNPDILFGEVLARPDWTQPTLNQEE… |
| A0A3L6N8L0 | 1-191 | MLDENLPTYRFKTSSENPLNNILYFTHNGSDPTPEYLIKRPAPSEANGQYALGIFDSQNTSVIYAEVDVKPDWVAPTLSAAEIRAQN… |
| A0A094GJ53 | 1-216 | None |
| A0A3N4INF3 | 1-201 | None |
| A0A0F4YZM2 | 503-718 | None |
| A0A6A6JSA3 | 1-220 | None |
| A0A124BXE6 | 338-555 | None |
| U4LQH5 | 1-169 | None |
| A0A2W1H7N6 | 1-208 | None |
| A0A063C7L7 | 1-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.