DPCstruct | MC39956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 135 ± 7 aa |
| Standard deviation of domain lengths | 7.23 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 40.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16483 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A232M1I6 | 104-238 | VEPSVANPTDPNINIRWGFCELTFNADQLYANVSSVDFVSLPISIGLTNSAGVTTVVQGLPPDGLDRICDQLMAQHQTDGAGWDQLI… |
| A0A0U1MC90 | 2-150 | DPLDPNAKIQWAFIELTYLATDDVFANLSYVDFVSLALGISLESANGTQTALGIRADGVTNICNDLRHQATLTGQPWDQLCVTDSAN… |
| A0A6M7ZBF5 | 171-304 | None |
| A0A1Z5TCU9 | 59-180 | None |
| A0A2H3HIP6 | 319-453 | None |
| A0A0F4ZB56 | 410-544 | None |
| A0A218YVA9 | 139-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.