DPCstruct | MC39952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 189 |
|---|---|
| Mean domain length (aa) | 153 ± 34 aa |
| Standard deviation of domain lengths | 34.40 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0528 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N1EHP3 | 20-146 | QNRLDTAPRELAETVQGDGDTRYFLGGFDLAEHEWLEVTMPPGLRGYWSLHVYSYWYEHLQRPGVHDRNAVVDPDGRVRIAVGPGWP… |
| A0A356IL46 | 58-201 | VAGASLLFAKWARDFQQHSNTLPQFDPEVSTAAGGDPNIIYYHSHWALTADEALLIEVTPPQCEHWNFQLNNYWMESLDYTHFQIHT… |
| A0A537IQX5 | 3-118 | None |
| A0A520DYH5 | 69-231 | None |
| A0A835XF78 | 297-539 | None |
| A0A521FLG5 | 30-192 | None |
| A0A7X1M706 | 2-131 | None |
| A0A2W7CPQ8 | 580-796 | None |
| A0A6J7UVX3 | 3-160 | None |
| A0A554PAN7 | 117-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.