DPCstruct | MC3995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 186 ± 30 aa |
| Standard deviation of domain lengths | 30.17 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00476 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444DHK4 | 135-285 | MNVGSDAQIRQLFFGDTLRRNDQNECLSKPKSFKVPNTENVIEDGRKSPSKYRTIVLNKICKKLQTDMYTDSGLPSVCGDALKIFAG… |
| A0A397B993 | 1-140 | MNLASASQKQQLLFAPFSNPHKNIELPVERLFDVDNIEQVVENPEKQSKPKKKRSIAIRGLGIPPVQFTASGNPAATADALKELAGN… |
| A0A453RWI4 | 204-398 | None |
| A0A6P5ZJT5 | 1-229 | None |
| A0A4S8IFU8 | 226-402 | None |
| A0A7I4CPA7 | 890-1129 | None |
| A0A7J6UZP0 | 518-687 | None |
| A0A1D6JFE0 | 274-469 | None |
| A0A2P2LDX0 | 600-794 | None |
| A0A0E0I7R8 | 645-810 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.