DPCstruct | MC39949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 223 ± 28 aa |
| Standard deviation of domain lengths | 27.60 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14664 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1F5E1 | 1-237 | MKFTACKLALTAMLKSWTGILYLCRPQLSSSSQPSSQPSSQPSSSQPPPSSSSLMGIKSLFKMLTLSSNETRKEILDIIFDVFRLQI… |
| A0A7R9I8A4 | 141-368 | EDREARFLCVRLALLSVLRSWPGILHFCHPSNSSGLQAIVSVLYLKQLEVRKAILDLLYDLLGLPQPEWTDEFSVALEAVDPSHPQD… |
| A0A7R9NZT6 | 166-411 | None |
| A0A815M482 | 27-222 | None |
| A0A381LJS5 | 446-643 | None |
| B4I736 | 47-249 | None |
| A0A4Y9ZL48 | 341-583 | None |
| A0A7R9K3F4 | 270-530 | None |
| A0A818EXZ7 | 1-167 | None |
| A0A182SNF7 | 110-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.