DPCstruct | MC39948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 164 ± 23 aa |
| Standard deviation of domain lengths | 23.32 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1F0V5 | 1-172 | MAFPQDAQDPFTKAITYLNLAAGADNSYYDMAALLGSDTFHDPTVSGDDQNDYPVLSFSTPQMAPPKFRMLPLELQEKLKHLQYNCQ… |
| A0A7D8V048 | 128-288 | ETVGKDEDPVYGPLSRARGKIERAIVSDSEISPDLAEQFAPTSEPPYLPPPTQTNAFRTARITKTTPLPDALHQELNYKHLTARMGL… |
| A0A0B2V1N9 | 1-178 | None |
| A0A1D6PG60 | 1-121 | None |
| K8EKE5 | 32-204 | None |
| A0A1I8IFS2 | 24-197 | None |
| A0A1X7UIM1 | 1-145 | None |
| A0A183E2Y5 | 1-203 | None |
| A0A1I7X780 | 1-167 | None |
| A0A6N2KWL1 | 15-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.