DPCstruct | MC39945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 126 ± 13 aa |
| Standard deviation of domain lengths | 12.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0603 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S2QMU1 | 11-129 | VSESVLRTASASSVRGLHEMPDHLKDVPTAENPRFFDMVEYFFHRACQVAEDKLVEDIKAKMSVEDKRKKVKGILLGMQPCDHILET… |
| T1EWQ7 | 79-203 | LPSIGALLSHSRSVATTSFLCSSSSPIDANDPEDNASFFEMVELYFDRASNLLEPALIKQSLSSAMPGSSNEDKVKKVKGILGIIKP… |
| A0A0B0EMW2 | 1-98 | None |
| A0A6A4WQF3 | 6-127 | None |
| A0A3L8D5V8 | 21-152 | None |
| A0A183U0Z2 | 1-131 | None |
| A0A432UVF8 | 3-107 | None |
| A0A1I8HTH3 | 1-115 | None |
| A0A834JWD7 | 83-230 | None |
| A0A674IQY3 | 43-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.