DPCstruct | MC39944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 227 ± 26 aa |
| Standard deviation of domain lengths | 25.81 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00681 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7XIM7 | 443-652 | ARECVNTALNQRVTVAEAVLANALNPRTGKFTDLQSRIELSLKEAHDYGLIQKPLTLTEVVDKGHYDSNGLFLDRGNRFTLLEAINA… |
| T1ETH1 | 2-233 | DKAKVVAEELKSTKVEERKKFIIKGVVDPRTNDHVAFKYAVSEGIINHRKGLYVNPSTNESLPIQRAMLEGKILVEYISVCRSLPET… |
| T1GIS1 | 135-379 | None |
| A0A813PEF5 | 21-247 | None |
| T1FVI2 | 330-529 | None |
| T1G1B5 | 380-610 | None |
| A0A183WH76 | 13-292 | None |
| A0A6A4VJ67 | 3-170 | None |
| A0A183QIN5 | 2-229 | None |
| A0A3P6TPT3 | 10-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.