DPCstruct | MC39942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 57 ± 4 aa |
| Standard deviation of domain lengths | 3.98 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 58.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08412 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183KM87 | 284-337 | SGSSFHLKEQFFAFFQPTGNKLAMKLFGTKLALDRERLRQEQQGDWIIHPCSNF |
| A0A448WJ09 | 278-330 | SASAYLKEQFLSFFQPSDNKLAMKLFGTKNALNKERRRQQQQGKWIIHPCSSF |
| A0A212F2B3 | 59-118 | None |
| A0A834KH94 | 83-134 | None |
| A0A6P8UB92 | 17-76 | None |
| E2BZX9 | 29-88 | None |
| A0A3S3P0R0 | 39-98 | None |
| Q4TEX5 | 11-62 | None |
| A0A060Y298 | 108-159 | None |
| A0A6P7FT27 | 232-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.