DPCstruct | MC39940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 81 ± 5 aa |
| Standard deviation of domain lengths | 4.88 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1EL14 | 1-74 | CHRIRTQIYYTSRKPDKIYGIIERLSTGSRKIELFGRLHNVRPNWVTITHQLPNIMIVDPKMKEAFSNSFPNGN |
| A0A7R9P176 | 8-83 | LNRGLDCDVIVAEVRATSHKPDEIYGIIERLSPGTRKIELFGRPHNVQPNWITLGNQVDGVRLVDPELIQAFRQRY |
| A0A427YC32 | 162-238 | None |
| S6B5P8 | 50-135 | None |
| A0A409XXN9 | 756-844 | None |
| A0A0C3SEN1 | 294-374 | None |
| A0A0D2K0T3 | 1-84 | None |
| A0A7J7PVE6 | 101-181 | None |
| Q3SE37 | 424-509 | None |
| A0A1J1ISQ6 | 464-539 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.