DPCstruct | MC3994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 168 ± 15 aa |
| Standard deviation of domain lengths | 15.02 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3J3G5 | 2-170 | MAIIALIHQDQHVAITADDEKLRDPEGYAAIVQLHHQMDDDQSGSIDRFESNDFLKEDMKFGGSDREKREKAFHHNNDEQITVDDLW… |
| A0A397AZD8 | 1-168 | MAAADATDSALALHAMEDEDQDGVMNPKELTVLREKLHHAFDTDASGRIEKDEMRSVLDHVSKEFNSMDKDDDSYVSTDELDSRYDQ… |
| K8F6C2 | 28-195 | None |
| A0A0N5ADQ6 | 1-134 | None |
| F6TB84 | 26-182 | None |
| A0A7S3VAB9 | 181-356 | None |
| A0A132ABL4 | 6-157 | None |
| A0A0R3RL15 | 30-190 | None |
| A0A830HDT3 | 182-369 | None |
| A0A5K3EW12 | 48-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.