DPCstruct | MC39934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 8.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0547 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1EJT9 | 1-80 | CSDRCNGRCYHNSVCCHDECAAGCHGLTDRDCNACAKLNDSGRCVSVCPSFQAYNATAFMWYPDPKGKFAHERNCVAECP |
| F6VNS2 | 105-176 | GPAREDCCDIECASGCTGPSDKDCITCLHVNNTGACEYTCPPARIYDPLTQRNIPNPHFKFHYHDHCVDACP |
| A0A3B4AJU6 | 180-260 | None |
| A0A482VNB6 | 178-260 | None |
| T1EEW8 | 59-143 | None |
| A0A3Q0KJB6 | 220-313 | None |
| A0A3B3VWM0 | 5-89 | None |
| A0A6L5D6B1 | 93-161 | None |
| A0A183WAS2 | 60-126 | None |
| W5QD61 | 6-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.