DPCstruct | MC39930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 135 ± 17 aa |
| Standard deviation of domain lengths | 17.21 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1EI78 | 1-116 | QWNPKRLTAETEFIMGSKANKALGLGATRGRVYMKHPDLFKYTSDQDDKQWLVENRYMSATGGKTYILILDDIRELAHTDEYRDCPG… |
| A0A3Q3CMJ1 | 4-133 | CVLRVKPKSEPIKKEGPKWDPSRLSDSSTFVLGSRANKALGMGGTRGRIYIKHADLFKYAADAKDKQWLAERHHMRAYLLIEEDIQD… |
| A0A1A9UPT6 | 173-310 | None |
| A0A653BZG9 | 115-289 | None |
| A0A0N5AHR4 | 146-275 | None |
| A0A672GGE6 | 91-226 | None |
| A0A452IK04 | 5-143 | None |
| A0A0R4IMU0 | 20-159 | None |
| A0A6F9DB46 | 205-361 | None |
| A0A087W113 | 373-504 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.