DPCstruct | MC39929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 215 ± 33 aa |
| Standard deviation of domain lengths | 33.47 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6H8H5 | 5-194 | YKHMYFNATKQTFMMWTITMAAVLGFYEVVKHLLRLHVEGNLRYSMLFLLLLDIHPHYYSWWGYLNYFNDDFYSQFVHQLFFTVTEL… |
| T1EH19 | 8-214 | QKPLVDKLRCTCNCFDTIFRGNYEWPPSMYKHVYFNTNLTTFKIWIISCLGVITCYEATKKILMIIKSKCTRLPMLVLLLSSLYPHY… |
| A0A1S3IL39 | 77-280 | None |
| A0A2A3EJT2 | 42-242 | None |
| A0A1Y2HLJ0 | 46-268 | None |
| A0A817NWX0 | 289-483 | None |
| A0A0D2MXP0 | 1-155 | None |
| A0A1B0CVX5 | 46-251 | None |
| A0A6L5C7S1 | 29-237 | None |
| A0A2T7NSM9 | 196-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.