DPCstruct | MC39927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 102 ± 17 aa |
| Standard deviation of domain lengths | 16.54 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 20.25 |
| Pfam Score | 98.75 |
| Assigned Pfam label(s) | CL0717- CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7CLH4 | 4-98 | QGIQQLADSVRRLRAGMRDITGTADSPDGLISATVGARGELLELELNPRVYRQPDSELLAADIVETIQRAVAAAQREVFELVKEFLP… |
| Q57XL2 | 26-122 | RQFHRILAFVYNNKYEYQIRFDRMEVVGREWGGRVEVVTTPAGYLKRVRVNPCVEDLTLYQQQQLILSAYASACADGRKLMEQAEMN… |
| A0A812KU02 | 146-229 | None |
| A0A1I6A4X8 | 5-100 | None |
| A0A076MYT5 | 9-86 | None |
| K0K7W5 | 2-75 | None |
| A0A365ZK81 | 2-82 | None |
| A0A3N9Y330 | 375-488 | None |
| J7T4U5 | 100-199 | None |
| A0A6I3KXE2 | 203-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.