DPCstruct | MC3992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 142 ± 15 aa |
| Standard deviation of domain lengths | 14.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1SSL2 | 120-236 | TEETIKKCLHGFDVEILDWMRVDMSARPLAATCPRLKRLTLYVSTWASLSYWVSGNGYEELSQLEMLRDVEVFILADLIGSSLGSSY… |
| A0A2V5HQB0 | 1-143 | MIRTHRTQSDEAIEECLDGLKVEVWNWKKIDLCTDVIAKEALETAREVSLYSSDSSGNNAVLLGWSSADGLARFPNLEKVHLYVREG… |
| A0A428UXU8 | 293-432 | None |
| A0A2L2TDJ0 | 24-158 | None |
| I8A9T3 | 2-134 | None |
| A0A4Z1IRN6 | 503-643 | None |
| A0A2N1M095 | 409-555 | None |
| A0A484FT62 | 569-702 | None |
| A0A5J5FBK8 | 234-358 | None |
| A0A1S8A6N0 | 437-610 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.