DPCstruct | MC39918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 61 ± 3 aa |
| Standard deviation of domain lengths | 3.30 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 54.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0143 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D4KQQ8 | 56-113 | GATWTNDISHGDLVRNNPDQTMTVDPCNLQFLYQGKSPSAGGPYDQLPWRPGVLTLRR |
| A0A1I1V5E9 | 1-58 | GATWTNDISHGELIRSNADQTMTVDPCNLQLLYQGRDPNSGGDYGRLPYRPGLLTLQR |
| A0A4V2TEI2 | 177-235 | None |
| A0A5C5YU46 | 196-260 | None |
| C4RBG8 | 1-64 | None |
| A0A2D5VI92 | 9-73 | None |
| A0A6A6GG71 | 100-157 | None |
| A0A1T3CUJ4 | 179-235 | None |
| A0A7W5ATC3 | 44-101 | None |
| A0A409YWJ0 | 65-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.