DPCstruct | MC39911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4190 |
|---|---|
| Mean domain length (aa) | 140 ± 27 aa |
| Standard deviation of domain lengths | 26.70 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 11.12 |
| Pfam Score | 79.49 |
| Assigned Pfam label(s) | PF05309- PF01327- CL0020- PF19843- PF07382 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0EBK1 | 17-154 | VISQSSAQGLDTPEETIAKWRAAVAAADVNAAMTLFAPNASGFATYSRAPISGTSEIRKLYENVLSRLNVPRGNETITISKTMVGES… |
| A0A3C0E9C5 | 3-111 | EDAWNTREPERVSLAYTVDSVWRNRAEFLSGREMIVQFLRRKWAKELDYRLIKEFWAFDDARISVRFAYEWRDDSGNWFRSYGNENW… |
| A0A066VAC4 | 27-201 | None |
| E2C2D4 | 5-142 | None |
| A0A358SIK2 | 13-135 | None |
| G8SLB7 | 162-345 | None |
| G8SC83 | 110-218 | None |
| A0A810LMU4 | 2-103 | None |
| A0A6L7GKZ0 | 109-232 | None |
| A0A7X4L0A7 | 204-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.