DPCstruct | MC39904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 118 ± 6 aa |
| Standard deviation of domain lengths | 6.45 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 50.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5EY13 | 28-139 | MEASAATVRSMCEQVDADLITLRERNEAAGLVRDYLIRRRVGELDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRH… |
| A0A4W6DFP4 | 1-123 | MRASLKTLHRLAEKVGADITVLREREVDYDSDIPRKIAEVLIRKVPDDQQFLDLRVAVLGNVDSGKSTLLGVLTQGELDNGRGRARL… |
| A0A7R9L3Z0 | 101-227 | None |
| A0A177ATQ1 | 69-191 | None |
| A0A6P9AL99 | 124-236 | None |
| R1DE34 | 85-198 | None |
| A0A5S6PSM8 | 63-171 | None |
| A0A7R9D2E5 | 131-253 | None |
| A0A821SZT6 | 87-201 | None |
| A0A7S3GA31 | 95-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.