DPCstruct | MC3990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 102 ± 8 aa |
| Standard deviation of domain lengths | 8.03 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A9P7T7 | 109-199 | VFVEEEPRMCWFRGKKCRWFGTAPTCGGTEFAVGEWNLYDSLQPQLVMTTQDTTWTKLCSEANSEGPGEDCCTMEKYGKECISGYKR… |
| A0A2V5H035 | 2-91 | LFATHASSKCQMAGFNECKWWGSSPFCGASKSTPGDTDSDGWLFVASTRTKNWDVLCREISDSCCRDYGDGCLTGYKRLWCHDSESV… |
| A0A2C5ZUA0 | 11-109 | None |
| A0A2C6A9F3 | 6-134 | None |
| A0A2C6ADZ7 | 1-107 | None |
| A0A5N6ELV9 | 1-102 | None |
| A0A318YEK1 | 62-167 | None |
| A0A2C5XX36 | 1-111 | None |
| A0A369GYW7 | 16-111 | None |
| A0A2C5Y840 | 1-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.