DPCstruct | MC399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 186 ± 21 aa |
| Standard deviation of domain lengths | 21.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0U1Z9 | 2-154 | QLRNEMQILFQAHTLATSTKDDDLVVLIDKWRTASRTVAEELFATTRDKVNRMGGVGAWNAREKEGKERQQQWDKEEREAERENMEE… |
| A0A1X7RQM5 | 1-230 | MPTSGLEFLEAQESEHHLSMSAVKRKRAEIATNRLSKPFRSPLGTGRKTSSATTTSLDVTIRKTKNDIDTLKQAHALSTSSTDADLE… |
| A0A167ZUZ4 | 143-337 | None |
| A0A0G2EKE8 | 92-262 | None |
| C4JY50 | 1-183 | None |
| A0A2P8A046 | 173-379 | None |
| A0A6S6WR32 | 495-668 | None |
| A0A5N7ARJ3 | 103-276 | None |
| A0A6A6YJK8 | 64-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.