DPCstruct | MC39895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 560 ± 91 aa |
| Standard deviation of domain lengths | 91.45 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R2CSS8 | 205-863 | MTFGEKPREDINTRGYEELMDAFSSHLFIIRKGVTLDTTPEFISFQRTYAQLWGKIIPAIKALEAMLSTFAVPKAIADGKKLVDLIG… |
| L9KIQ8 | 119-589 | LRNLNCQEPNPKSVKVTTPRAPKSSWDYDFSIFNGNIDMTTPDFLAFKEHFSLAWGSIFSLLEHIEKFLRDYAIPEVKIKGKSLVAL… |
| A0A0L7QQZ8 | 1-505 | None |
| A0A3B4A669 | 50-721 | None |
| A0A7M5X0I4 | 349-1035 | None |
| A0A183LFP6 | 215-780 | None |
| A0A2Y9R1I9 | 5-587 | None |
| A0A3R7A0F7 | 107-545 | None |
| A0A226PC71 | 194-678 | None |
| A0A7N9AZE8 | 20-705 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.