DPCstruct | MC39893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 297 ± 64 aa |
| Standard deviation of domain lengths | 64.27 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 71.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 40.51 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | CL0264- PF09335 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L9KGH7 | 74-376 | YYVEGAHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGAIS… |
| A0A067R8P9 | 107-454 | FLDLYIYGIKLFQYRLALGIVLLVTIVCSVLVNIGGPHQQYWDSVCKQTMWCLYWLGLGVLSSVGLGTGLHTFLLYLGPHIATVTLA… |
| A0A1B6LC91 | 51-404 | None |
| H9JTU1 | 2-275 | None |
| A0A812UJH1 | 2-221 | None |
| A0A5E4QDM6 | 1-208 | None |
| A0A1Y1VH86 | 41-390 | None |
| A0A7S1QY60 | 229-526 | None |
| S9U4W6 | 152-409 | None |
| A0A4Y2J3X7 | 4-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.