DPCstruct | MC39891
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 127 ± 26 aa |
| Standard deviation of domain lengths | 25.70 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1EIN5 | 4-95 | TCRLMDYRNQAVATFTVDGRDLICLPQAFELFLKHLVGGLHTVYTKLKRLDVVPVVCNVEQVRVLRSLGAIQPGVNRCKLISPKEFD… |
| L9JBE4 | 18-125 | TPQNNECKMVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLIS… |
| B4E035 | 54-168 | None |
| T1DBP2 | 31-136 | None |
| A0A226EWR1 | 20-161 | None |
| A0A2G8LDE0 | 65-206 | None |
| A0A5B7E0A8 | 154-314 | None |
| A0A7E4W2Q0 | 55-162 | None |
| A0A0K0E204 | 347-441 | None |
| A0A0N4Z7E1 | 253-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.