DPCstruct | MC3989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 273 ± 48 aa |
| Standard deviation of domain lengths | 47.55 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 25.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0012 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S7WBE6 | 2-211 | SLYTHEIKTMMYSFGDVRDPLTESASYLEDVVKSNIQHLLNIANGIKIHQKRKSIGIEDICFALRKDPFKVKRIKDCIAYKKYKKNI… |
| A0A2V5GWQ3 | 17-327 | EDADVESEEQFRDRLTNTWRQMMFVSGETAEPSVETTTLIEEIVRQQVVEILARSTALATRRGVRSISTDDLIFLIRHDKAKVSRLK… |
| A0A2G8LFV2 | 65-274 | None |
| A0A1V6TIH5 | 324-622 | None |
| A0A5J5CRR1 | 25-239 | None |
| A0A1B7YGP5 | 13-300 | None |
| A0A2P8ZHT6 | 20-203 | None |
| A0A0G4MQM8 | 132-445 | None |
| R8BPX9 | 135-467 | None |
| A0A1X7TP62 | 10-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.