DPCstruct | MC39889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 118 ± 16 aa |
| Standard deviation of domain lengths | 15.60 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04664 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8Y4X6 | 16-123 | LTCPSSSQSRVTGPRNWRALQDMRRYRHHYPDLVDLDCNGDMPNLSFYRNEIRFLPDGCFIEDILQNWRGNYELLEDNHSYIQWLFP… |
| A0A815G3N2 | 126-225 | DDSDEEENSSYTSWAQRDIAEYRNGYPDVRQYPQIKDNYKFYANKMPSFPHGDYIDNIHDKWFGDYHRLEIHHGYIQWLFPLQEKGL… |
| A0A674AFS7 | 177-313 | None |
| A0A5N3VMN8 | 3-120 | None |
| A0A7J6CF19 | 46-170 | None |
| M3Y969 | 26-155 | None |
| A0A4W5P556 | 2-110 | None |
| A0A7R9FR33 | 6-134 | None |
| A0A6A5F5X2 | 16-143 | None |
| A0A6J0CEY3 | 68-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.