DPCstruct | MC39888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 128 |
|---|---|
| Mean domain length (aa) | 146 ± 28 aa |
| Standard deviation of domain lengths | 28.10 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.44 |
| Pfam Score | 65.77 |
| Assigned Pfam label(s) | CL0192- CL0144- CL0607- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5M2S1 | 2-107 | FDENGDPPAAYDIINWQLNKGVVSHVTVGHFDTSPDGGSQLVIDEDSIVWSTGRELPTGVCSESCPPGTRRAARKGQPICCFDCIPC… |
| L8Y1A2 | 386-526 | LSSEIGTLLELYKIPQLHPFLRKIQFTNGAGDNTSLDDKNNHVTQYDVQNLVRFPDKSWVLVKVGEFFSKSSHNQDLVINEEMIKWP… |
| A0A061QP75 | 32-218 | None |
| W5M2Y4 | 46-207 | None |
| A0A6P6RDR5 | 212-351 | None |
| A0A061QMY1 | 150-323 | None |
| A0A2I4CLL0 | 27-156 | None |
| A0A7R9L4H5 | 23-152 | None |
| A0A4Z2HJI0 | 227-426 | None |
| A0A2G8LNN8 | 101-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.