DPCstruct | MC39887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 194 ± 29 aa |
| Standard deviation of domain lengths | 29.32 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6AHA1 | 1-189 | MTNEELFLKTLKDIKVRARPNGQDEYDVLMLTPLLRKLLIDARPLVEVINQKYRLKVKYTITNYSFPPYPGDPEPAFWAIQDGFDPG… |
| A0A3M8AK84 | 2-205 | GYLDDSCERYDARVRSEHQPLAAAILALVHDSDTTAGLLSRIGLRSALPWADGTLEGDPLWVRDSVTTGPIPVVSMLTVVRAQGRSS… |
| A0A1V5DLL4 | 2-189 | None |
| A0A0E2Z5V5 | 3-171 | None |
| A0A0Q4FJ87 | 1-256 | None |
| A0A857J8F7 | 11-206 | None |
| A0A257Q8C7 | 9-246 | None |
| L7KNM8 | 2-127 | None |
| A0A1C3F880 | 47-219 | None |
| A0A1E8Q187 | 19-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.