DPCstruct | MC39885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 235 ± 44 aa |
| Standard deviation of domain lengths | 43.92 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 13.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1YLI9 | 36-255 | ATKTPTSVSDSFLITPATSNAIGVIDWVNFIKFNDITYVAGDNPGRTLTEADLGPEFAKVRSKLADTVGDPSYRSQNSDAAFLEAGT… |
| A0A7X8HME8 | 14-210 | YPSVKFNNKEYGIKLSSPVSENVLGDPLGSCEATGVDSYTNKKYSETFKAYKINGVSEDKLIAAGTEGEFYVYMADDISKPATFGDV… |
| A0A7V8N2W2 | 3-237 | None |
| A0A1M7M6Y6 | 295-528 | None |
| A0A7X9HUV3 | 33-285 | None |
| A0A7X3IL82 | 12-240 | None |
| U2D693 | 180-400 | None |
| A0A6L7RWG1 | 119-333 | None |
| A0A7X8W6X3 | 27-271 | None |
| A0A1S8TC28 | 238-498 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.