DPCstruct | MC3988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 346 ± 48 aa |
| Standard deviation of domain lengths | 47.99 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q8QDX5 | 428-739 | ATLIRHGLYGLTEAMPDFALHALRFAPKPLMQSVALIGCLEYHSRRRFFAQAARTPWFATEWAAMPALATCKSILALCAEYGLDSPL… |
| A0A6G3M404 | 32-381 | LTASDGVKLLIHMDQLCHLVFSMTDRKDAMLALRNLDILDQFSCMDDLKKNVAQMDQDWCSLSETMKLSREFLELFEENILSFICEN… |
| A0A7X3SLW9 | 1-343 | None |
| A0A7X3MML1 | 249-635 | None |
| A0A6T8YVZ8 | 38-430 | None |
| A0A7C1BDG5 | 2-264 | None |
| A0A3A9J490 | 417-786 | None |
| A0A812IB69 | 36-446 | None |
| A0A7W9SSZ9 | 585-867 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.