DPCstruct | MC39878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 4.27 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9XWU0 | 59-125 | EALAAVGLHTTEACGDVPRTIIGCPLAGIAADEVIDATPQLREIHDRYIGSPEFSNLPRKYKTALSG |
| A0A7X5I4A5 | 3-69 | GLTSLQSGMDNVRNPVGNPIAGIDPDEIVDTRPYTNLLSQYITANSRGNPAFTNLPRKWNVCVIGSH |
| A0A2V7I7C3 | 520-587 | None |
| A0A090V9D8 | 120-175 | None |
| S4XBP3 | 619-686 | None |
| A0A832GJI1 | 109-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.