DPCstruct | MC39876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 267 ± 57 aa |
| Standard deviation of domain lengths | 56.77 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2LSF9 | 16-292 | AGIIAGGPYGCSQGRLDTATAVCSCTGLLPCNIKPGGTHPAALAATAATYEKQGGIAPLANLARHRIWLFSGAADTLVPRPVMDDLQ… |
| A0A1Q5U7B0 | 1-234 | MKSWSGNKIAPTSNLQNRKIYLWGGSGDTTVGPNVMNALNSQLSNFDTSADVSYVTTSGAVHTFPTDFDGSGDNSCSMSSSPYISNC… |
| A0A821ICS0 | 1-299 | None |
| A0A813DUH9 | 330-618 | None |
| A0A3D8T2L1 | 249-553 | None |
| A0A817MJQ6 | 7-136 | None |
| A0A365VT38 | 13-264 | None |
| A0A226EX97 | 64-306 | None |
| A0A258VA39 | 2-166 | None |
| A0A5A8CKE5 | 45-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.